PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012922.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family NAC
Protein Properties Length: 286aa    MW: 32243.3 Da    PI: 6.3114
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012922.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.55.1e-5331301128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtd+elv +yLk+kv+g k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat sgyWkatgkd+++ + +
  Aco012922.1   3 LPPGFRFHPTDDELVGYYLKRKVDGLKIEL-EVIPVIDLYKFEPWELPdKsFLPKKDMEWFFFCPRDRKYPNGSRTNRATLSGYWKATGKDRKIAC-E 98 
                  79****************************.99**************96434556788**************************************.8 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++  gl+ktLvfy+grap ge+tdW+mheyrl
  Aco012922.1  99 NSIYGLRKTLVFYRGRAPGGERTDWIMHEYRL 130
                  899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-592153IPR003441NAC domain
PROSITE profilePS5100556.6683153IPR003441NAC domain
PfamPF023657.3E-294130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MTLPPGFRFH PTDDELVGYY LKRKVDGLKI ELEVIPVIDL YKFEPWELPD KSFLPKKDME  60
WFFFCPRDRK YPNGSRTNRA TLSGYWKATG KDRKIACENS IYGLRKTLVF YRGRAPGGER  120
TDWIMHEYRL CEDLSQGSSN FLGAFALCHI VKRNDHGQKG GGFCGEFRAK KYPKECHSNA  180
SSSSEENSIH VTDQSSISNG STPITASPQI QRETDLPPVA AGIDQNDYGT PHPTSDPPKL  240
IDLYIINDSG NETWNSLVAP AICRQASEGE EAHLWLQEDT MVFVI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-56115915171NAC domain-containing protein 19
4dul_A1e-56115915171NAC domain-containing protein 19
1ut7_B1e-56115915171NO APICAL MERISTEM PROTEIN
1ut7_A1e-56115915171NO APICAL MERISTEM PROTEIN
1ut4_B1e-56115915171NO APICAL MERISTEM PROTEIN
1ut4_A1e-56115915171NO APICAL MERISTEM PROTEIN
3swp_D1e-56115918174NAC domain-containing protein 19
3swp_C1e-56115918174NAC domain-containing protein 19
3swp_B1e-56115918174NAC domain-containing protein 19
3swp_A1e-56115918174NAC domain-containing protein 19
3swm_D1e-56115918174NAC domain-containing protein 19
3swm_C1e-56115918174NAC domain-containing protein 19
3swm_B1e-56115918174NAC domain-containing protein 19
3swm_A1e-56115918174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933504.11e-120PREDICTED: NAC domain-containing protein 45-like
RefseqXP_010933505.11e-120PREDICTED: NAC domain-containing protein 45-like
SwissprotQ9FFI54e-69NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM0SVB51e-112M0SVB5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P03360_0011e-112(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.12e-86NAC domain containing protein 71